Referenzen |
Startseite Produktepeptides intermediates

Enfuvirtide Acetate CAS:159519-65-0

Alle Produkte

cosmetic peptides

(701)

peptides intermediates

(315)

cosmetic peptide for hair care

(27)

recombinant protein

(82)

custom peptide synthesis

(130)

other cosmetic raw material

(29)

Hot sell peptide

(0)
Beste Produkte
Semax CAS:80714-61-0 High Purity Raw Peptide Powder

Semax CAS:80714-61-0 High Purity Raw Peptide Powder

Selank CAS:129954-34-3 High Purity Raw Peptide Powder

Selank CAS:129954-34-3 High Purity Raw Peptide Powder

Semaglutide 99% Purity CAS:910463-68-2 Quality Peptide with Factory Price

Semaglutide 99% Purity CAS:910463-68-2 Quality Peptide with Factory Price

Bescheinigung
China Chengdu YoungShe Chemical Co.,Ltd zertifizierungen
Ich bin online Chat Jetzt

Enfuvirtide Acetate CAS:159519-65-0

Enfuvirtide Acetate CAS:159519-65-0
Enfuvirtide Acetate CAS:159519-65-0 Enfuvirtide Acetate CAS:159519-65-0 Enfuvirtide Acetate CAS:159519-65-0 Enfuvirtide Acetate CAS:159519-65-0

Großes Bild :  Enfuvirtide Acetate CAS:159519-65-0

Produktdetails:
Herkunftsort: China
Markenname: YS
Zertifizierung: ISO9001
Modellnummer: YSCP
Zahlung und Versand AGB:
Min Bestellmenge: 1g
Preis: Verhandelbar
Verpackung Informationen: 1 g/Flasche, 10 g/Flasche, 100 g/Flasche oder nach Maß
Lieferzeit: 5 Tage
Zahlungsbedingungen: T/T, Paypal, Western Union, Geldgramm
Versorgungsmaterial-Fähigkeit: Schüttgut
Kontakt

Enfuvirtide Acetate CAS:159519-65-0

Beschreibung
Aussehen: Weißes Pulver Haltbarkeit: 2 Jahre
Reinheit: 95 % ~ 99 %

Product Information Name:Enfuvirtide Acetate Cas No: 159519-65-0 Formular: C204H301N51O64 Molecular:4491.87 Sequence: AC-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2 Purity:98% Appearance: white powder Source: synthetic Also known as: Pentafuside, Fuzeon, DP178, T-20, T 20 (peptide), Dp 178 Note: For lab research use only Shelf Life 2 years Apperance White Powder Purity(by HPLC) ≥95% Hot-sell peptide BPC157 Semaglutide TB500 Tirze patide Thymosin beta 4 (TB4) Reta trutide GHRP-2

Kontaktdaten
Chengdu YoungShe Chemical Co.,Ltd

Ansprechpartner: Ms. Aileen Chen

Telefon: +8619150309904

Faxen: 86-28-62328193

Senden Sie Ihre Anfrage direkt an uns (0 / 3000)

Um

cosmetic peptides

peptides intermediates

KPV peptide α-MSH (11-13) CAS:67727-97-3

Reta Tirze Sema Quality Peptide

Dihexa Peptide CAS:77614-16-5

NACHRICHT HINTERLASSEN

Datenschutz-Bestimmungen | China peptides intermediates Anbieter. Copyright © 2016 - 2026 Chengdu YoungShe Chemical Co.,Ltd. All Rights Reserved. Developed by ECER