Startseite Produkte peptides intermediates

Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29)

Name: Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29)
Brand: Chengdu YoungShe Chemical Co.,Ltd
SKU: YSCP
Price: Verhandelbar USD
Availability: InStock

Alle Produkte

cosmetic peptides
(701)

peptides intermediates
(315)

cosmetic peptide for hair care
(27)

recombinant protein
(82)

custom peptide synthesis
(130)

other cosmetic raw material
(29)

Hot sell peptide
(0)

Beste Produkte

Semax CAS:80714-61-0 High Purity Raw Peptide Powder

Selank CAS:129954-34-3 High Purity Raw Peptide Powder

Semaglutide 99% Purity CAS:910463-68-2 Quality Peptide with Factory Price

Bescheinigung

China Chengdu YoungShe Chemical Co.,Ltd zertifizierungen

Ich bin online Chat Jetzt

Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29)

Großes Bild : Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29)

Produktdetails:

Herkunftsort:	China
Markenname:	YS
Zertifizierung:	ISO9001
Modellnummer:	YSCP

Zahlung und Versand AGB:

Min Bestellmenge:	1g
Preis:	Verhandelbar
Verpackung Informationen:	1 g/Flasche, 10 g/Flasche, 100 g/Flasche oder nach Maß
Lieferzeit:	5 Tage
Zahlungsbedingungen:	T/T
Versorgungsmaterial-Fähigkeit:	Schüttgut

Kontakt

Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29)

Beschreibung

Aussehen:	Weißes Pulver	Haltbarkeit:	2 Jahre
Reinheit:	95 % ~ 99 %

Product Information Name: Sermorelin Acetate Cas No: 86168-78-7 Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder Source: synthetic Also known as: Geref, UNII-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Serono Brand of Sermorelin, Sermorelina, Sermorelinum, Geref (TN), Sermoreline [French]. Shelf Life 2 years Apperance White Powder Purity(by HPLC) ≥95% Hot-sell peptide BPC157 Semaglutide TB500 Tirze patide

Kontaktdaten

Chengdu YoungShe Chemical Co.,Ltd

Ansprechpartner: Ms. Aileen Chen

Telefon: +8619150309904

Faxen: 86-28-62328193

Andere Produkte

Selank CAS:129954-34-3

Aussehen: Weißes Pulver

Haltbarkeit: 2 Jahre

Reinheit: 95 % ~ 99 %

Tirze patide CAS:2023788-19-2 Quality Peptide Pure White Powder 99% Purity

Aussehen: Weißes Pulver

Haltbarkeit: 2 Jahre

Reinheit: 95 % ~ 99 %

KPV peptide Lys-Pro-Val CAS:67727-97-3 raw peptide

Aussehen: Weißes Pulver

Haltbarkeit: 2 Jahre

Reinheit: 95 % ~ 99 %

Reta trutide CAS: 2381089-83-2 Quality Peptide Pure White Powder 99% Purity

Aussehen: Weißes Pulver

Haltbarkeit: 2 Jahre

Reinheit: 99 %

Klotho-abgeleitetes Peptid 1 KP1 reines Pulver

Aussehen: Weißes Pulver

Haltbarkeit: 2 Jahre

Reinheit: 95 % ~ 99 %

Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29)

cosmetic peptides

peptides intermediates

cosmetic peptide for hair care

recombinant protein

custom peptide synthesis

other cosmetic raw material

Hot sell peptide

Semax CAS:80714-61-0 High Purity Raw Peptide Powder

Selank CAS:129954-34-3 High Purity Raw Peptide Powder

Semaglutide 99% Purity CAS:910463-68-2 Quality Peptide with Factory Price

Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29)

Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29)

Selank CAS:129954-34-3

Tirze patide CAS:2023788-19-2 Quality Peptide Pure White Powder 99% Purity

KPV peptide Lys-Pro-Val CAS:67727-97-3 raw peptide

Reta trutide CAS: 2381089-83-2 Quality Peptide Pure White Powder 99% Purity

Klotho-abgeleitetes Peptid 1 KP1 reines Pulver

cosmetic peptides

peptides intermediates

KPV peptide α-MSH (11-13) CAS:67727-97-3

Reta Tirze Sema Quality Peptide

Dihexa Peptide CAS:77614-16-5