Referenzen |
Startseite Produktepeptides intermediates

Teriparatide Acetate peptide powder pure powder

Alle Produkte

cosmetic peptides

(701)

peptides intermediates

(315)

cosmetic peptide for hair care

(27)

recombinant protein

(82)

custom peptide synthesis

(130)

other cosmetic raw material

(29)

Hot sell peptide

(0)
Beste Produkte
Semax CAS:80714-61-0 High Purity Raw Peptide Powder

Semax CAS:80714-61-0 High Purity Raw Peptide Powder

Selank CAS:129954-34-3 High Purity Raw Peptide Powder

Selank CAS:129954-34-3 High Purity Raw Peptide Powder

Semaglutide 99% Purity CAS:910463-68-2 Quality Peptide with Factory Price

Semaglutide 99% Purity CAS:910463-68-2 Quality Peptide with Factory Price

Bescheinigung
China Chengdu YoungShe Chemical Co.,Ltd zertifizierungen
Ich bin online Chat Jetzt

Teriparatide Acetate peptide powder pure powder

Teriparatide Acetate peptide powder pure powder
Teriparatide Acetate peptide powder pure powder Teriparatide Acetate peptide powder pure powder Teriparatide Acetate peptide powder pure powder Teriparatide Acetate peptide powder pure powder

Großes Bild :  Teriparatide Acetate peptide powder pure powder

Produktdetails:
Herkunftsort: China
Markenname: YS
Zertifizierung: ISO9001
Modellnummer: YSCP
Zahlung und Versand AGB:
Min Bestellmenge: 1g
Preis: Verhandelbar
Verpackung Informationen: 1 g/Flasche, 10 g/Flasche, 100 g/Flasche oder nach Maß
Lieferzeit: 5 Tage
Zahlungsbedingungen: T/T
Versorgungsmaterial-Fähigkeit: Schüttgut
Kontakt

Teriparatide Acetate peptide powder pure powder

Beschreibung
Aussehen: Weißes Pulver Haltbarkeit: 2 Jahre
Reinheit: 95 % ~ 99 %

Product Information Name:Teriparatide Acetate, Teriparatida , Teriparatidum Cas No: 52232-67-4(net),99294-94-7(acetate) Formula: C181H291N55O51S2 Molecular: 4117.71 Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity:98% Appearance: white powder Source: synthetic Also know as Aventis Brand of Teriparatide,Forteo,hPTH (1-34),Human Parathyroid Hormone (1-34),Lilly Brand of Teriparatide Parathar,Teriparatide Acetate,Teriparatide Aventis Brand Shelf Life 2 years Apperance White

Kontaktdaten
Chengdu YoungShe Chemical Co.,Ltd

Ansprechpartner: Ms. Aileen Chen

Telefon: +8619150309904

Faxen: 86-28-62328193

Senden Sie Ihre Anfrage direkt an uns (0 / 3000)

Um

cosmetic peptides

peptides intermediates

KPV peptide α-MSH (11-13) CAS:67727-97-3

Reta Tirze Sema Quality Peptide

Dihexa Peptide CAS:77614-16-5

NACHRICHT HINTERLASSEN

Datenschutz-Bestimmungen | China peptides intermediates Anbieter. Copyright © 2016 - 2026 Chengdu YoungShe Chemical Co.,Ltd. All Rights Reserved. Developed by ECER