Referenzen |
Startseite Produktepeptides intermediates

Exenatide Acetate Cas No:141732-76-5

Alle Produkte

cosmetic peptides

(701)

peptides intermediates

(315)

cosmetic peptide for hair care

(27)

recombinant protein

(82)

custom peptide synthesis

(130)

other cosmetic raw material

(29)

Hot sell peptide

(0)
Beste Produkte
Semax CAS:80714-61-0 High Purity Raw Peptide Powder

Semax CAS:80714-61-0 High Purity Raw Peptide Powder

Selank CAS:129954-34-3 High Purity Raw Peptide Powder

Selank CAS:129954-34-3 High Purity Raw Peptide Powder

Semaglutide 99% Purity CAS:910463-68-2 Quality Peptide with Factory Price

Semaglutide 99% Purity CAS:910463-68-2 Quality Peptide with Factory Price

Bescheinigung
China Chengdu YoungShe Chemical Co.,Ltd zertifizierungen
Ich bin online Chat Jetzt

Exenatide Acetate Cas No:141732-76-5

Exenatide Acetate Cas No:141732-76-5
Exenatide Acetate Cas No:141732-76-5 Exenatide Acetate Cas No:141732-76-5 Exenatide Acetate Cas No:141732-76-5 Exenatide Acetate Cas No:141732-76-5

Großes Bild :  Exenatide Acetate Cas No:141732-76-5

Produktdetails:
Herkunftsort: China
Markenname: YS
Zertifizierung: ISO9001
Modellnummer: YSCP
Zahlung und Versand AGB:
Min Bestellmenge: 1g
Preis: Verhandelbar
Verpackung Informationen: 1 g/Flasche, 10 g/Flasche, 100 g/Flasche oder nach Maß
Lieferzeit: 5 Tage
Zahlungsbedingungen: T/T
Versorgungsmaterial-Fähigkeit: Schüttgut
Kontakt

Exenatide Acetate Cas No:141732-76-5

Beschreibung
Aussehen: Weißes Pulver Haltbarkeit: 2 Jahre
Reinheit: 95 % ~ 99 %

Product Information Name:Exenatide Acetate, Exenatida Cas No:141732-76-5 Formula: C186H286N50O62S Molecular:4246.62 Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Purity:98% Appearance: white powder Source: synthetic Also know as AC 2993, Bydureon, Byetta, Exenatide synthetic, Synthetic exendin-4 Note: For lab research use only Shelf Life 2 years Apperance White Powder Purity(by HPLC) ≥95% Hot-sell peptide BPC157 Semaglutide TB500 Tirze patide Thymosin beta 4 (TB4) Reta

Kontaktdaten
Chengdu YoungShe Chemical Co.,Ltd

Ansprechpartner: Ms. Aileen Chen

Telefon: +8619150309904

Faxen: 86-28-62328193

Senden Sie Ihre Anfrage direkt an uns (0 / 3000)

Um

cosmetic peptides

peptides intermediates

KPV peptide α-MSH (11-13) CAS:67727-97-3

Reta Tirze Sema Quality Peptide

Dihexa Peptide CAS:77614-16-5

NACHRICHT HINTERLASSEN

Datenschutz-Bestimmungen | China peptides intermediates Anbieter. Copyright © 2016 - 2026 Chengdu YoungShe Chemical Co.,Ltd. All Rights Reserved. Developed by ECER