Referenzen |
Startseite Produktepeptides intermediates

ACTH(1-39) CAS:9002-60-2 peptide synthesis

Alle Produkte

cosmetic peptides

(701)

peptides intermediates

(315)

cosmetic peptide for hair care

(27)

recombinant protein

(82)

custom peptide synthesis

(130)

other cosmetic raw material

(29)

Hot sell peptide

(0)
Beste Produkte
Semax CAS:80714-61-0 High Purity Raw Peptide Powder

Semax CAS:80714-61-0 High Purity Raw Peptide Powder

Selank CAS:129954-34-3 High Purity Raw Peptide Powder

Selank CAS:129954-34-3 High Purity Raw Peptide Powder

Semaglutide 99% Purity CAS:910463-68-2 Quality Peptide with Factory Price

Semaglutide 99% Purity CAS:910463-68-2 Quality Peptide with Factory Price

Bescheinigung
China Chengdu YoungShe Chemical Co.,Ltd zertifizierungen
Ich bin online Chat Jetzt

ACTH(1-39) CAS:9002-60-2 peptide synthesis

ACTH(1-39) CAS:9002-60-2 peptide synthesis
ACTH(1-39) CAS:9002-60-2 peptide synthesis ACTH(1-39) CAS:9002-60-2 peptide synthesis ACTH(1-39) CAS:9002-60-2 peptide synthesis ACTH(1-39) CAS:9002-60-2 peptide synthesis

Großes Bild :  ACTH(1-39) CAS:9002-60-2 peptide synthesis

Produktdetails:
Herkunftsort: China
Markenname: YS
Zertifizierung: ISO9001
Modellnummer: YSCP
Zahlung und Versand AGB:
Min Bestellmenge: 1g
Preis: Verhandelbar
Verpackung Informationen: 1 g/Flasche, 10 g/Flasche, 100 g/Flasche oder nach Maß
Lieferzeit: 5 Tage
Zahlungsbedingungen: T/T
Versorgungsmaterial-Fähigkeit: Schüttgut
Kontakt

ACTH(1-39) CAS:9002-60-2 peptide synthesis

Beschreibung
Aussehen: Weißes Pulver Haltbarkeit: 2 Jahre
Reinheit: 95 % ~ 99 %

Product Information Name: ACTH(1-39), Corticotropin Cas No: 9002-60-2 Formula: C207H308N56O58S Molecular: 4541.0658 Sequence: SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF Purity:98% Appearance: white powder Source: synthetic Also known as: Adrenocorticotropin, ACTH, Corticotrophine, Corticotrofina, Cortrophin, Corticotrophinum Note: For lab research use only Shelf Life 2 years Apperance White Powder Purity(by HPLC) ≥95% Hot-sell peptide BPC157 Semaglutide TB500 Tirze patide

Kontaktdaten
Chengdu YoungShe Chemical Co.,Ltd

Ansprechpartner: Ms. Aileen Chen

Telefon: +8619150309904

Faxen: 86-28-62328193

Senden Sie Ihre Anfrage direkt an uns (0 / 3000)

Um

cosmetic peptides

peptides intermediates

KPV peptide α-MSH (11-13) CAS:67727-97-3

Reta Tirze Sema Quality Peptide

Dihexa Peptide CAS:77614-16-5

NACHRICHT HINTERLASSEN

Datenschutz-Bestimmungen | China peptides intermediates Anbieter. Copyright © 2016 - 2026 Chengdu YoungShe Chemical Co.,Ltd. All Rights Reserved. Developed by ECER