B7-33 peptide CAS: 1818415-56-3

Product Information Name: B7-33 peptide CAS No.:1818415-56-3 Sequence: VIKLSGRELVRAQIAISGMSTWSKRSL-NH2 Molecular formula: C131H229 N41O36S Molecular weight: 2986.58 Source: synthesis Appearance: white powder Purity: >95% Shelf life:> 2 years Notice: For research use only Shelf Life 2 years Apperance White Powder Purity(by HPLC) ≥95% Company Information This product is stable for 24 months from date of manufacture at -20℃ to -15℃ in a freezer. Protected from light, keep