Klotho-derived peptide 6 Pure Powder CAS No.:2102414-23-1

Product Information Name: Klotho-derived peptide 6 CAS No.: 2102414-23-1 Sequence: QPVVTLYHWDLPQRLQDAYGGWANRALADH Molecular formula: C159H232N46O44 Molecular weight: 3491.8 g/mol Source: synthesis Appearance: white powder Purity: >95% Shelf life:> 2 years Notice: For research use only Shelf Life 2 years Apperance White Powder Purity(by HPLC) ≥95% Company Information This product is stable for 24 months from date of manufacture at -20℃ to -15℃ in a freezer. Protected from