Startseite Produktecopper peptides Online-Hersteller
Bescheinigung
China Chengdu YoungShe Chemical Co.,Ltd zertifizierungen
Ich bin online Chat Jetzt

copper peptides online manufacture

(100)
kaufen Cathelicidin-BF (snake cathelicidin) Peptide Synthesis online Hersteller

Cathelicidin-BF (snake cathelicidin) Peptide Synthesis

Product Information Name: Cathelicidin-BF CAS No. : NA Sequence: KFFRKLKKSVKKRAKEFFKKPRVIGVSIPF Molecular formula: C52H88N10O15 Molecular weight : 3637.54 Purity: >98.0% Source: synthetic MSDS and COA: ... Lesen Sie weiter
2026-01-21 17:21:42
kaufen BPC157 bpc-157 High Purity Peptide 99% Purity online Hersteller

BPC157 bpc-157 High Purity Peptide 99% Purity

Product Information Basic information: Name: BPC157 Formular: C43H66N12O12S2 Molecular:1419 Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val Purity:98% Appearance: white powder Source: ... Lesen Sie weiter
2026-02-05 17:08:59
kaufen Histrelin Acetate peptide on sale Chengdu Youngshe online Hersteller

Histrelin Acetate peptide on sale Chengdu Youngshe

Product Information Name: Histrelin Acetate Cas No: 76712-82-8 (net), 220810-26-4 (acetate) Formula:1323.52 Molecular: C66H86N18O12 Sequence: Pyr-His-Trp-Ser-Tyr-D-His(Bzl)-Leu-Arg-Pro-NHEt acetate salt Purity... Lesen Sie weiter
2026-01-20 11:14:35
kaufen Lanreotide Acetate peptide powder online Hersteller

Lanreotide Acetate peptide powder

Product Information Name: Lanreotide Acetate Cas No: 108736-35-2 (net), 127984-74-1 (acetate) Formula: C54H69N11O10S2 Molecular: 1096.34 Sequence: H-D-2-Nal-Cys-Tyr-D-Trp-Lys-Val-Cys-Thr-NH2 (Disulfide bond) ... Lesen Sie weiter
2026-01-20 11:10:13
kaufen Melanotan I CAS:75921-69-6 MT1 pure peptide powder online Hersteller

Melanotan I CAS:75921-69-6 MT1 pure peptide powder

Product Information Name:Melanotan I Cas No:75921-69-6 Formula:C78H111N21O19 Molecular:1646.8 Purity:98% Appearance: white powder Source: synthetic Shelf Life 2 years Apperance White Powder Purity(by HPLC) ≥95% ... Lesen Sie weiter
2026-01-20 10:34:54
kaufen Oxytocin CAS:50-56-6 High Purity Peptide Powder online Hersteller

Oxytocin CAS:50-56-6 High Purity Peptide Powder

Product Information Name:Oxytocin Acetate Cas No: 50-56-6(net) Formula: C43H66N12O12S2 Molecular:1007 Sequence: CYIQNCPLG Purity:98% Appearance: white powder Source: synthetic Also known as: Pitocin, Syntocinon... Lesen Sie weiter
2026-01-20 10:07:11
kaufen Pasireotide peptide supply online Hersteller

Pasireotide peptide supply

Product Information Name:Pasireotide Acetate Cas No: 396091-73-9 (net), 396091-76-2(acetate) Formula: C58H67N10O10 Molecular: 1064.23 Sequence: Cyclo(-Hyp(2-aminoethyl-carbamoyl)-Phg-D-Trp-Lys-Tyr(Bzl)-Phe) ... Lesen Sie weiter
2026-01-20 09:58:45
kaufen Peptide YY (3-36) (human) Acetate online Hersteller

Peptide YY (3-36) (human) Acetate

Product Information 1.Basic information: Name: Peptide YY (3-36) (human) Acetate Cas No: 123583-37-9 (net) Formula: C180H279N53O54 Molecular: 4049.52 Sequence:H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro... Lesen Sie weiter
2026-01-20 09:55:00
kaufen Secretolin peptide supply online Hersteller

Secretolin peptide supply

Product Information Name: Secretolin Cas No: 67307-60-2 (citrate (salt)), 9002-77-1, 17034-35-4 Formula: C130H219N43O42 Molecular: 3056.39 Sequence: HSDGTFTSELSRLRDSARLQRLLQGLV Purity:98% Appearance: white ... Lesen Sie weiter
2026-01-20 09:48:44
kaufen Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29) online Hersteller

Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29)

Product Information Name: Sermorelin Acetate Cas No: 86168-78-7 Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder Source: synthetic Also known ... Lesen Sie weiter
2026-01-20 09:33:14
Page 4 of 10|< 1 2 3 4 5 6 7 8 9 10 >|