Startseite Produktecopper peptides Online-Hersteller
Bescheinigung
China Chengdu YoungShe Chemical Co.,Ltd zertifizierungen
Ich bin online Chat Jetzt

copper peptides online manufacture

(100)
kaufen C-peptide CAS:59112-80-0 online Hersteller

C-peptide CAS:59112-80-0

Product Information Name: C-peptide CAS No.: 59112-80-0 Molecular formula: C129H211N35O48 Molecular weight: 3020.29 Purity: >98.0% Packing : According to clients’ requirements Source : Synthetic Shipping : ... Lesen Sie weiter
2025-12-29 17:24:33
kaufen Dermorphin peptide CAS:77614-16-5 High Purity online Hersteller

Dermorphin peptide CAS:77614-16-5 High Purity

Product Information Name: Dermorphin CAS NO.: 77614-16-5 Sequence: H-Tyr-D-Ala-Phe-Gly-Tyr-Pro-Ser-NH2 Molecular formula: C40H50N8O10 Purity: >98.0% Packing : According to clients’ requirements Source : ... Lesen Sie weiter
2026-01-19 11:49:41
kaufen P21 Peptide peptide6C p21 peptide online Hersteller

P21 Peptide peptide6C p21 peptide

Product Information Name: P21 Peptide CAS No. : N/A Sequence: Ac–DGGL(A)G-NH2 Molecular formula: C30H54N6O5 Molecular weight : 579.3 Purity: >95.0% Source: synthetic Description: Researchers found that the main ... Lesen Sie weiter
2025-12-29 16:41:10
kaufen Larazotide CAS:881851-50-9 High purity peptide online Hersteller

Larazotide CAS:881851-50-9 High purity peptide

Product Information Product name: Larazotide CAS No.:881851-50-9 Alias: Unii-zn3R5560zv Sequence: H-Gly-Gly-Val-Leu-Val-Gln-Pro-Gly-OH Molecular formula: C32H55N9O10 Molecular weight: 725.83 Appearance: white ... Lesen Sie weiter
2026-01-20 11:10:45
kaufen GHRP-6 Acetate CAS:87616-84-0 peptide synthesis online Hersteller

GHRP-6 Acetate CAS:87616-84-0 peptide synthesis

Product Information Name:GHRP-6 Acetate Cas No:87616-84-0 Formula: C46H56N12O6 Molecular:873 Sequence: His-Trp-Ala-Trp-Phe-LysNH2 Purity:98% Appearance: white powder Source: synthetic Also known as: growth ... Lesen Sie weiter
2026-01-20 11:20:40
kaufen ACTH(1-39) CAS:9002-60-2 peptide synthesis online Hersteller

ACTH(1-39) CAS:9002-60-2 peptide synthesis

Product Information Name: ACTH(1-39), Corticotropin Cas No: 9002-60-2 Formula: C207H308N56O58S Molecular: 4541.0658 Sequence: SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF Purity:98% Appearance: white powder Source: ... Lesen Sie weiter
2026-01-21 17:14:58
kaufen Cetrorelix Acetate CAS:120287-85-6 Peptide Synthesis online Hersteller

Cetrorelix Acetate CAS:120287-85-6 Peptide Synthesis

Product Information Name:Cetrorelix Acetate Cas No: 120287-85-6 Formula: C72H96ClN17O16 Molecular:1491 Sequence:Ac-D-Nal-D-Cpa-Ser-Tyr-D-Cit-Leu-Arg-Pro-D-Ala-NH2 Purity:98% Appearance: white powder Source: ... Lesen Sie weiter
2026-01-21 17:16:21
kaufen Cilengitide CAS:188968-51-6 High Purity peptide online Hersteller

Cilengitide CAS:188968-51-6 High Purity peptide

Product Information Name: Cilengitide Cas No: 188968-51-6 Formula: C27H40N8O7 Molecular:588.65 Sequence: Cyclo(L-arginylglycyl-L-alpha-aspartyl-D-phenylalanyl-N-methyl-L-valyl) Purity:98% Appearance: white ... Lesen Sie weiter
2026-01-21 17:19:27
kaufen Carfilzomib CAS:868540-17-4 Custom Peptide Synthesis online Hersteller

Carfilzomib CAS:868540-17-4 Custom Peptide Synthesis

Product Information Basic information: Name: Carfilzomib Other Name: PR-171 Appearance: White Powder Molecular Formula: C40H57N5O7 Molecular Weight: 719.91 CAS-Number: 868540-17-4 Purity >98%. Storage Temp.: 2... Lesen Sie weiter
2026-01-21 17:20:56
kaufen Bradykinin Acetate Cas No: 5979-11-3 High Purity Peptide online Hersteller

Bradykinin Acetate Cas No: 5979-11-3 High Purity Peptide

Product Information Basic information: Name: Bradykinin Acetate Synonym:BK;L-Bradykinin;Callidin I;CallidinI;Callidin-I;KallidinI;Kallidin I;Kallidin-I;C acid;C-acid;Kallidin 9;Kallidin-9;Kallidin9;Bradykinin ... Lesen Sie weiter
2026-02-03 17:15:05
Page 6 of 10|< 1 2 3 4 5 6 7 8 9 10 >|