copper peptides online manufacture

Product Information Name: Sincalide Cas No: 25126-32-3 Formula: C49H62N10O16S3 Molecular:1143.26 Sequence: Asp-Tyr[SO3 H]-Met-Gly-Trp-Met -Asp-Phe-NH2 Purity:98% Appearance: white powder Source: synthetic Also ... Lesen Sie weiter

Product Information Basic information: Product Name: Taltirelin Molecular Formula: C17H31N7O9 Molecular Weight: 477.46 Cas No: 103300-74-9 Synonyms: taltirelin hydrate; (1-methyl-4,5-dihydroorotyl)-histidyl... Lesen Sie weiter

Product Information Name: Teduglutide Cas No: 197922-42-2 Formula: C164H252N44O55S Molecular:3752 Sequence: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD Purity:98% Appearance: white powder Source: synthetic Also known as: ... Lesen Sie weiter

Product Information Name:Teriparatide Acetate, Teriparatida , Teriparatidum Cas No: 52232-67-4(net),99294-94-7(acetate) Formula: C181H291N55O51S2 Molecular: 4117.71 Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF ... Lesen Sie weiter

Product Information Name:Terlipressin Acetate, Terlipressine, Terlipressina, Terlipressinum, Heamopressin. Cas No: 14636-12-5(net), 914453-96-6(acetate) Formula: C52H74N16O15S2 Molecular:1227.36 Sequence:Gly... Lesen Sie weiter

Product Information Basic information: Product Name: Tesamorelin CAS:218949-48-5 Molecular Formula: C221H366N72O67S Molecular Weight: 5135.77794 PubChem: CID 44201342 Synonyms: Hex-hGRF, ThGRF(1-44), TH-9507, ... Lesen Sie weiter

Product Information Name: Vasopressin, Vasopressina, vasopressine Cas No: 11000-17-2 Formula: C43H67N15O12S2 Molecular: 1050.21 Sequence:1-[19-amino-7-(2-amino-2-oxoethyl)-10-(3-amino-3-oxopropyl)-13-butan-2-yl... Lesen Sie weiter

Product Information Name: abaloparatide CAS No. :247062-33-5 Sequence: H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Glu-Leu-Leu-Glu-Lys-Leu-Leu-Aib-Lys-Leu-His-Thr-Ala... Lesen Sie weiter

Product Information Name: alpha-Endorphin Cas No.: 61512-76-3 Sequence: Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr Molecular formula: C77H120N18O26S Molecular weight: 1745.97 Purity: >98.0% ... Lesen Sie weiter

Product Information Description: Arg-Gly-Asp is a primary sequence in cellular recognition. It is involved with the binding of proteins to cell surfaces and has strong affinity and selectivity to the alpha(V... Lesen Sie weiter